Bioactive grade

Recombinant human CD30 protein (Active) (Biotin) (ab246036)

Description

  • Product name

    Recombinant human CD30 protein (Active) (Biotin)
    See all CD30 proteins and peptides
  • Biological activity

    Assay #1: Immobilized anti-CD30 MAb, Human IgG1 at 5 μg/mL (100 μL/well) can bind ab246036 with a linear range of 0.4-6.5 ng/mL (Routinely tested).

    Assay #2: Immobilized Human CD30 Ligand, Mouse IgG2a Fc Tag, low endotoxin at 5 μg/mL (100 μL/well) can bind ab246036 with a linear range of 10-78 ng/mL (QC tested).

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQ CEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSA VNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKE PSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSV GRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLV EKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMA EKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPT SAPVALSSTGK
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      19 to 379
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      Extracellular domain. AviTag sequence: GLNDIFEAQKIEWHE
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246036 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.4
    Constituents: PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 mins at room temperature with occasional gentle mixing.

General Info

  • Alternative names

    • CD 30
    • CD30
    • CD30 antigen
    • CD30L receptor
    • Cytokine receptor CD30
    • D1S166E
    • KI 1
    • KI 1 antigen
    • Ki-1 antigen
    • KI1
    • Lymphocyte activation antigen CD30
    • TNFRSF 8
    • Tnfrsf8
    • TNR8_HUMAN
    • Tumor necrosis factor receptor superfamily member 8
    see all
  • Function

    Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B.
  • Sequence similarities

    Contains 6 TNFR-Cys repeats.
  • Post-translational
    modifications

    Phosphorylated on serine and tyrosine residues.
  • Cellular localization

    Cytoplasm and Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE - Human CD30 protein (Active) (ab246036).

    The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%. The protein migrates at 60-100 kDa under reducing conditions (SDS-PAGE) due to glycosylation.

  • Immobilized anti-CD30 MAb, Human IgG1 at 5 μg/mL (100 μL/well) can bind ab246036 with a linear range of 0.4-6.5 ng/mL (Routinely tested).

  • Immobilized Human CD30 Ligand, Mouse IgG2a Fc Tag, low endotoxin at 5 μg/mL (100 μL/well) can bind ab246036 with a linear range of 10-78 ng/mL (QC tested).

References

ab246036 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246036.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up