Description

  • Product name

    Recombinant Human CD30 protein (Fc Chimera)
    See all CD30 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQ CEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSA VNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKE PSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSV GRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLV EKTPCAWNSSRTCECRPGMICATSATNSRARCVPYPICAAETVTKPQDMA EKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPT SAPVALSSTGK
    • Predicted molecular weight

      65 kDa including tags
    • Amino acids

      19 to 379
    • Additional sequence information

      Extracellular domain fused with a human IgG1 Fc tag (Pro 100 - Lys 330; P01857) at the C-terminus (NP_001234.2).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab220597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD 30
    • CD30
    • CD30 antigen
    • CD30L receptor
    • Cytokine receptor CD30
    • D1S166E
    • KI 1
    • KI 1 antigen
    • Ki-1 antigen
    • KI1
    • Lymphocyte activation antigen CD30
    • TNFRSF 8
    • Tnfrsf8
    • TNR8_HUMAN
    • Tumor necrosis factor receptor superfamily member 8
    see all
  • Function

    Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B.
  • Sequence similarities

    Contains 6 TNFR-Cys repeats.
  • Post-translational
    modifications

    Phosphorylated on serine and tyrosine residues.
  • Cellular localization

    Cytoplasm and Cell membrane.
  • Information by UniProt

Images

  • Immobilized Human CD30 Ligand, Mouse IgG2a Fc Tag, at 5 μg/mL (100 μL/well) can bind ab220597 with a linear range of 8-125 ng/mL.

  • Immobilized Human CD30 Ligand, Mouse IgG2a Fc Tag, at 2 μg/mL (100 μL/well) can bind ab220597 with a linear range of 0.5-31 ng/mL

  • SDS-PAGE analysis of reduced ab220597 stained overnight with Coomassie Blue.

    The protein migrates as 100-130 kDa under reducing conditions (SDS-PAGE) due to glycosylation.

References

ab220597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up