Description

  • Product name

    Recombinant Human CD300C protein (His tag)
    See all CD300C proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVE TKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDF HDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPE PSPHPGSLFSNVR
    • Predicted molecular weight

      19 kDa including tags
    • Amino acids

      21 to 183
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (AAH22279).

Specifications

Our Abpromise guarantee covers the use of ab217819 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilised from 0.22 µm filtered solution.

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD300 antigen-like family member C
    • CD300c
    • CD300c antigen
    • CD300c molecule
    • CLM-6
    • CLM6_HUMAN
    • CMRF-35
    • CMRF-35A
    • CMRF35
    • CMRF35 antigen
    • CMRF35 leukocyte immunoglobulin-like receptor
    • CMRF35-A1
    • CMRF35-like molecule 6
    • CMRF35A
    • CMRF35A leukocyte immunoglobulin-like receptor
    • CMRF35A1
    • IgSF16
    • Immunoglobulin superfamily member 16
    • LIR
    see all
  • Tissue specificity

    Present on the surface of monocytes, neutrophils, a proportion of peripheral blood T- and B-lymphocytes and lymphocytic cell lines.
  • Sequence similarities

    Belongs to the CD300 family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab217819 followed by staining overnight with Coomassie Blue.

    DTT-reduced protein migrates as 25-45 kDa in SDS-PAGE due to glycosylation.

References

ab217819 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217819.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up