Description

  • Product name

    Recombinant human CD32 protein
    See all CD32 proteins and peptides
  • Biological activity

    The bioactivity is measured by its binding ability to Ipilimumab in a SPR assay.
    Immobilized ab207140 can bind Ipilimumab with affinity constant of around 2.7 µM.
    Measured by its binding ability in a functional ELISA.
    Immobilized MPDL3280A mAb at 10 μg/mL (100 µl/well) can bind ab207140 with a linear of 0.1-2 μg/mL. 

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTH TQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQE GETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDY HCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
    • Predicted molecular weight

      21 kDa including tags
    • Amino acids

      36 to 218
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab207140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.

General Info

  • Alternative names

    • CD32
    • CD32A
    • CD32B
    • CD32C
    • CDw32
    • Fc fragment of IgG low affinity IIa receptor
    • Fc fragment of IgG low affinity IIa receptor for (CD32)
    • Fc fragment of IgG low affinity IIb receptor
    • Fc fragment of IgG low affinity IIb receptor for (CD32)
    • Fc fragment of IgG low affinity IIc receptor
    • Fc fragment of IgG low affinity IIc receptor for (CD32)
    • Fc fragment of IgG, low affinity II, receptor for (CD32)
    • Fc fragment of IgG, low affinity IIa, receptor (CD32)
    • Fc fragment of IgG, low affinity IIb, receptor (CD32)
    • Fc gamma receptor IIB
    • Fc gamma receptor IIC
    • Fc gamma RII a
    • Fc gamma RII b
    • Fc gamma RII c
    • Fc gamma RIIb
    • Fc gamma RIIc
    • Fc receptor
    • Fc receptor, IgG, low affinity IIb
    • Fc-gamma RII-a
    • Fc-gamma RII-b
    • Fc-gamma RII-c
    • Fc-gamma-RIIa
    • FC-gamma-RIIB
    • Fc-GAMMA-RIIC
    • Fc[g]RII
    • FCG2
    • FCG2A_HUMAN
    • FcGR
    • FCGR2
    • FCGR2A
    • FCGR2A1
    • FCGR2B
    • FCGR2C
    • Fcgr3
    • Fcgr3a
    • FcgRII
    • Fcr-2
    • Fcr-3
    • FCRII
    • FcRII a
    • FcRII b
    • FcRII c
    • FcRII-a
    • FcRII-b
    • FcRIIC
    • IGFR2
    • IgG Fc receptor II a
    • IgG Fc receptor II b
    • IgG Fc receptor II beta
    • IgG Fc receptor II c
    • IgG Fc receptor II-a
    • IgG Fc receptor II-b
    • IgG Fc receptor II-c
    • Immunoglobulin G Fc receptor II
    • Immunoglobulin G Fc receptor II c
    • Low affinity immunoglobulin gamma Fc region receptor II
    • Low affinity immunoglobulin gamma Fc region receptor II-a
    • Low affinity immunoglobulin gamma Fc region receptor II-b
    • Low affinity immunoglobulin gamma Fc region receptor II-c
    • Ly-17
    • Ly-m20
    • Lym 1
    • LyM-1
    • Lymphocyte antigen 17
    see all
  • Function

    Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens.
  • Tissue specificity

    Found on monocytes, neutrophils and eosinophil platelets.
  • Sequence similarities

    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • Immobilized�Human CD32a (H167), His Tag (SPR�& BLI verified) on CM5 Chip via anti-His antibody, can bind��Rituximab�with an�affinity constant of 1.45 µM as determined in a SPR assay (Biacore�T200).
  • Human CD32a (H167), His Tag (SPR�& BLI verified) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • Loaded Human CD32a (H167), His Tag (SPR�& BLI verified) on HIS1K Biosensor, can bind Rituximab with an affinity constant of 1.30 µM as determined in BLI assay.
  • DTT-reduced SDS-PAGE analysis of ab207140 stained overnight with Coomassie Blue.
    DTT-reduced protein migrates as 29-32 kDa in SDS-PAGE due to glycosylation.

References

ab207140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up