Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPT HTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQ EGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGD YHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGII
    • Molecular weight
      21 kDa including tags
    • Amino acids
      34 to 218
    • Tags
      His tag C-Terminus
    • Additional sequence information
      (AAH19931.1)

Specifications

Our Abpromise guarantee covers the use of ab173994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to bind Human IgG with an estimated KD <60 nM.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 97 % SDS-PAGE.

  • Form
    Lyophilised
  • Additional notes

    After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Please see notes section.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CD32
    • CD32 antigen
    • CDw32
    • Fc fragment of IgG, low affinity IIa, receptor (CD32)
    • Fc fragment of IgG, low affinity IIa, receptor for (CD32)
    • Fc gamma RII a
    • Fc gamma RIIa
    • Fc-gamma RII-a
    • Fc-gamma-RIIa
    • FCG2
    • FCG2A_HUMAN
    • FcGR
    • FCGR2
    • FCGR2A
    • FCGR2A1
    • FcRII a
    • FcRII-a
    • IGFR2
    • IgG Fc receptor II a
    • IgG Fc receptor II-a
    • Immunoglobulin G Fc receptor II
    • low affinity immunoglobulin gamma Fc region receptor II a
    • Low affinity immunoglobulin gamma Fc region receptor II-a
    see all
  • Function
    Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
  • Tissue specificity
    Found on monocytes, neutrophils and eosinophil platelets.
  • Sequence similarities
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN, HCK and SYK.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • Reduced SDS-PAGE analysis of ab173994, stained overnight with Coomassie Blue.

    Predicted MW of protein with tag is 21.3 kDa, but DTT-reduced protein migrates as 29-32 kDa due to glycosylation.

References

ab173994 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up