Bioactive grade

Recombinant human CD32A protein (Active) (Biotin) (ab246082)

Description

  • Product name

    Recombinant human CD32A protein (Active) (Biotin)
    See all CD32A proteins and peptides
  • Biological activity

    ab246082 captured on Biotin CAP-Series S Sensor Chip can bind Rituximab with an affinity constant of 2.15 μM as determined in a SPR assay (Biacore T200).

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTH TQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQE GETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDY HCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      36 to 218
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      AviTag sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • CD32
    • CD32 antigen
    • CDw32
    • Fc fragment of IgG, low affinity IIa, receptor (CD32)
    • Fc fragment of IgG, low affinity IIa, receptor for (CD32)
    • Fc gamma RII a
    • Fc gamma RIIa
    • Fc-gamma RII-a
    • Fc-gamma-RIIa
    • FCG2
    • FCG2A_HUMAN
    • FcGR
    • FCGR2
    • FCGR2A
    • FCGR2A1
    • FcRII a
    • FcRII-a
    • IGFR2
    • IgG Fc receptor II a
    • IgG Fc receptor II-a
    • Immunoglobulin G Fc receptor II
    • low affinity immunoglobulin gamma Fc region receptor II a
    • Low affinity immunoglobulin gamma Fc region receptor II-a
    see all
  • Function

    Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
  • Tissue specificity

    Found on monocytes, neutrophils and eosinophil platelets.
  • Sequence similarities

    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN, HCK and SYK.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • Loaded Biotinylated Human CD32a (R167),�Avitag,His�Tag (SPR�& BLI verified) on SA Biosensor, can bind Rituximab with an affinity constant of 0.9 µM as determined in BLI assay.
  • SDS-PAGE - Human CD32A protein (Active) (Biotin) (ab246082).

    The gel was stained overnight with Coomassie Blue.

    The protein migrates as 32-42 kDa under reducing conditions due to glycosylation.

     

  • ab246082 captured on Biotin CAP-Series S Sensor Chip can bind Rituximab with an affinity constant of 2.15 μM as determined in a SPR assay (Biacore T200).

References

ab246082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246082.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up