Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPS YRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETI VLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTG NIGYTLYSSKPVTITVQAPS
    • Molecular weight
      20 kDa including tags
    • Amino acids
      46 to 217
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to bind human IgG with an estimated KD <150 nM.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Please see notes section.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • CD32
    • CD32 antigen
    • CD32B
    • CDw32
    • Fc fragment of IgG, low affinity II, receptor for (CD32)
    • Fc fragment of IgG, low affinity IIb, receptor
    • Fc fragment of IgG, low affinity IIb, receptor (CD32)
    • Fc fragment of IgG, low affinity IIb, receptor for
    • Fc fragment of IgG, low affinity IIb, receptor for (CD32)
    • Fc gamma receptor IIB
    • Fc gamma RII
    • Fc gamma RIIB
    • Fc-gamma RII
    • Fc-gamma RII-b
    • Fc-gamma-RIIb
    • FCG2
    • FCG2B_HUMAN
    • Fcgr2
    • FCGR2B
    • FCRII
    • FcRII-b
    • IGFR2
    • IgG Fc receptor II beta
    • IgG Fc receptor II-b
    • Low affinity immunoglobulin gamma Fc region receptor II
    • Low affinity immunoglobulin gamma Fc region receptor II-b
    • Ly-17
    • Lym 1
    • Lymphocyte antigen 17
    see all
  • Function
    Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells (TCR) or via another Fc receptor. Isoform IIB1 fails to mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis.
  • Tissue specificity
    Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cells.
  • Involvement in disease
    Note=A chromosomal aberration involving FCGR2B is found in a follicular lymphoma. Translocation t(1;22)(q22;q11). The translocation leads to the hyperexpression of the receptor. This may play a role in the tumor progression.
  • Sequence similarities
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain
    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • The purity of ab174051 was determined by reduced SDS PAGE and staining overnight with Coomassie Blue.

    Lane 1: MW markers

    Lane 2: ab174051 (predicted MW 20kDa), DTT-reduced ab174051 migrates as 23-33 kDa due to different glycosylation.

     

References

ab174051 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up