Bioactive grade

Recombinant human CD32B protein (Active) (Biotin) (ab246026)

Description

  • Product name

    Recombinant human CD32B protein (Active) (Biotin)
    See all CD32B proteins and peptides
  • Biological activity

    Assay 1: ab246026 captured on Biotin CAP-Series S Sensor Chip can bind Rituximab with an affinity constant of 5 μM as determined in a SPR assay (Biacore T200).

    Assay 2: Immobilized ab246026 on SA Chip, can bind Rituximab with an affinity constant of 4.22 μM as determined in a SPR assay (Biacore T200).

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHT QPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEG ETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYH CTGNIGYTLYSSKPVTITVQAP
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      46 to 217
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      Extracellular domain. AviTag sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • CD32
    • CD32 antigen
    • CD32B
    • CDw32
    • Fc fragment of IgG, low affinity II, receptor for (CD32)
    • Fc fragment of IgG, low affinity IIb, receptor
    • Fc fragment of IgG, low affinity IIb, receptor (CD32)
    • Fc fragment of IgG, low affinity IIb, receptor for
    • Fc fragment of IgG, low affinity IIb, receptor for (CD32)
    • Fc gamma receptor IIB
    • Fc gamma RII
    • Fc gamma RIIB
    • Fc-gamma RII
    • Fc-gamma RII-b
    • Fc-gamma-RIIb
    • FCG2
    • FCG2B_HUMAN
    • Fcgr2
    • FCGR2B
    • FCRII
    • FcRII-b
    • IGFR2
    • IgG Fc receptor II beta
    • IgG Fc receptor II-b
    • Low affinity immunoglobulin gamma Fc region receptor II
    • Low affinity immunoglobulin gamma Fc region receptor II-b
    • Ly-17
    • Lym 1
    • Lymphocyte antigen 17
    see all
  • Function

    Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells (TCR) or via another Fc receptor. Isoform IIB1 fails to mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis.
  • Tissue specificity

    Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cells.
  • Involvement in disease

    Note=A chromosomal aberration involving FCGR2B is found in a follicular lymphoma. Translocation t(1;22)(q22;q11). The translocation leads to the hyperexpression of the receptor. This may play a role in the tumor progression.
  • Sequence similarities

    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain

    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • Loaded Biotinylated Human CD32b, Avitag,His Tag (SPR�& BLI verified) on SA Biosensor, can bind Rituximab with an affinity constant of 2.7 µM as determined in BLI assay.
  • SDS-PAGE - Recombinant human CD32B protein (Active) (Biotin) (ab246026).

    The protein migrates as 25 kDa and 30-35 kDa under reducing conditions due to glycosylation.

  • ab246026 captured on Biotin CAP-Series S Sensor Chip can bind Rituximab with an affinity constant of 5 μM as determined in a SPR assay (Biacore T200).

  • Immobilized ab246026 on SA Chip, can bind Rituximab with an affinity constant of 4.22 μM as determined in a SPR assay (Biacore T200).

References

ab246026 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up