Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAII SRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYF FRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSW ACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFA GAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
    • Molecular weight
      53 kDa including tags
    • Amino acids
      18 to 259
    • Additional sequence information
      Recombinant Human CD33 Protein fragment (extracellular domain) fused with Fc fragment of Human IgG1 at the C-terminus.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab174052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by the ability of the immobilized protein to support the adhesion of Human red blood cells.

    The ED50 for this effect is typically 1.2-4.8 µg/ml.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes

    After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Please see notes section.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • CD 33
    • CD33
    • CD33 antigen
    • CD33 antigen (gp67)
    • CD33 molecule
    • CD33_HUMAN
    • FLJ00391
    • gp67
    • My9
    • Myeloid cell surface antigen CD33
    • Myeloid cell surface antigen CD33 precursor
    • Myeloid differentiation antigen CD33
    • p67
    • Sialic acid binding Ig like lectin 3
    • Sialic acid binding immunoglobulin like lectin 3
    • Sialic acid-binding Ig-like lectin 3
    • SIGLEC 3
    • Siglec-3
    • SIGLEC3
    see all
  • Function
    Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro).
  • Tissue specificity
    Monocytic/myeloid lineage cells.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain
    Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications
    Phosphorylation of Tyr-340 is involved in binding to PTPN6 and PTPN11. Phosphorylation of Tyr-358 is involved in binding to PTPN6.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • The purity of ab174052 was determined by reduced SDS-PAGE and staining overnight with Coomassie Blue.

    Lane 1: MW markers

    Lane 2: ab174052 (predicted MW of 53kDa)  DTT-reduced ab174052 migrates at 62-85 kDa due to glycosylation

References

ab174052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up