Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSQ RAQLERSLRDVVEKTIQKYGTNPE ETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLS ATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQ KWLHNN
    • Molecular weight

      17 kDa including tags
    • Amino acids

      112 to 241
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_001765. Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab187610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 89% PBS

General Info

  • Alternative names

    • CD 37
    • CD37
    • CD37 antigen
    • CD37 molecule
    • CD37_HUMAN
    • Cell differentiation antigen 37
    • GP52 40
    • Leukocyte antigen CD37
    • Leukocyte surface antigen CD37
    • MGC120234
    • Tetraspanin 26
    • Tetraspanin-26
    • Tetraspanin26
    • TSPAN 26
    • Tspan-26
    • TSPAN26
    see all
  • Tissue specificity

    B-lymphocytes.
  • Sequence similarities

    Belongs to the tetraspanin (TM4SF) family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE of ab187610 3µg loaded.

References

ab187610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up