Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGA FISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQR DMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWK TVSRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKN PEDSSCTSEI
    • Molecular weight
      31 kDa including tags
    • Amino acids
      43 to 300
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174013 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C long term. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 50 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Acute lymphoblastic leukemia cells antigen CD38
    • ADP ribosyl cyclase
    • ADP ribosyl cyclase 1
    • ADP ribosyl cyclase/cyclic ADP-ribose hydrolase
    • ADP-ribosyl cyclase 1
    • ADPRC 1
    • ADPRC1
    • cADPr hydrolase 1
    • CD 38
    • CD38
    • CD38 antigen
    • CD38 antigen (p45)
    • CD38 molecule
    • Cd38-rs1
    • CD38_HUMAN
    • CD38H
    • Cyclic ADP ribose hydrolase
    • Cyclic ADP ribose hydrolase 1
    • Cyclic ADP-ribose hydrolase 1
    • EC 3.2.2.5
    • Ecto nicotinamide adenine dinucleotide glycohydrolase
    • I-19
    • I19 (mouse)
    • Lymphocyte differentiation antigen CD38
    • NAD(+) nucleosidase
    • NIM-R5 antigen
    • NIMR5 antigen (mouse)
    • OTTHUMP00000158633
    • OTTHUMP00000217743
    • p45
    • T10
    see all
  • Function
    Synthesizes cyclic ADP-ribose, a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system.
  • Tissue specificity
    Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma.
  • Sequence similarities
    Belongs to the ADP-ribosyl cyclase family.
  • Developmental stage
    Preferentially expressed at both early and late stages of the B and T-cell maturation. It is also detected on erythroid and myeloid progenitors in bone marrow, where the level of surface expression was shown to decrease during differentiation of blast-forming unit E to colony-forming unit E.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • Reduced SDS-PAGE analysis of ab174013, stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 30-45 kDa due to glycosylation.

References

ab174013 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174013.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up