Description

  • Product name

    Recombinant Human CD38 protein
    See all CD38 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPEFVPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWD AFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQ VQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSV FWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQT LEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQC VKNPEDSSCTSEIHHHHHH
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      43 to 300
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab222440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: 10% Glycerol, 0.98% MES, 0.58% Sodium chloride

General Info

  • Alternative names

    • Acute lymphoblastic leukemia cells antigen CD38
    • ADP ribosyl cyclase
    • ADP ribosyl cyclase 1
    • ADP ribosyl cyclase/cyclic ADP-ribose hydrolase
    • ADP-ribosyl cyclase 1
    • ADPRC 1
    • ADPRC1
    • cADPr hydrolase 1
    • CD 38
    • CD38
    • CD38 antigen
    • CD38 antigen (p45)
    • CD38 molecule
    • Cd38-rs1
    • CD38_HUMAN
    • CD38H
    • Cyclic ADP ribose hydrolase
    • Cyclic ADP ribose hydrolase 1
    • Cyclic ADP-ribose hydrolase 1
    • EC 3.2.2.5
    • Ecto nicotinamide adenine dinucleotide glycohydrolase
    • I-19
    • I19 (mouse)
    • Lymphocyte differentiation antigen CD38
    • NAD(+) nucleosidase
    • NIM-R5 antigen
    • NIMR5 antigen (mouse)
    • OTTHUMP00000158633
    • OTTHUMP00000217743
    • p45
    • T10
    see all
  • Function

    Synthesizes cyclic ADP-ribose, a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system.
  • Tissue specificity

    Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma.
  • Sequence similarities

    Belongs to the ADP-ribosyl cyclase family.
  • Developmental stage

    Preferentially expressed at both early and late stages of the B and T-cell maturation. It is also detected on erythroid and myeloid progenitors in bone marrow, where the level of surface expression was shown to decrease during differentiation of blast-forming unit E to colony-forming unit E.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 3μg ab222440 analyzed by 15% SDS-PAGE.

     

References

ab222440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up