Description

  • Product name

    Recombinant Human CD39 protein
    See all CD39 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEDTKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYG IVLDAGSSHTSLYIYKWPAEKENDTGVVHQVEECRVKGPGISKFVQKVNE IGIYLTDCMERAREVIPRSQHQETPVYLGATAGMRLLRMESEELADRVLD VVERSLSNYPFDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFSIVP YETNNQETFGALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYNVYT HSFLCYGKDQALWQKLAKDIQVASNEILRDPCFHPGYKKVVNVSDLYKTP CTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFL PPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTS YAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGKIQGSDAGW TLGYMLNLTNMIPAEQPLSTPLSHSTYVFLMVLFSLVLFTVAIIGLLIFH KPSYFWKDMV
    • Predicted molecular weight

      82 kDa including tags
    • Amino acids

      1 to 510

Specifications

Our Abpromise guarantee covers the use of ab114445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATPDase
    • CD 39
    • CD39
    • CD39 antigen
    • DKFZp686D194
    • DKFZp686I093
    • Ecto apyrase
    • Ecto ATP diphosphohydrolase
    • Ecto-apyrase
    • Ecto-ATP diphosphohydrolase 1
    • Ecto-ATPase 1
    • Ecto-ATPDase 1
    • Ectonucleoside triphosphate diphosphohydrolase 1
    • ENTP1_HUMAN
    • ENTPD 1
    • ENTPD1
    • FLJ40921
    • FLJ40959
    • Lymphoid cell activation antigen
    • NTPDase 1
    • NTPDase1
    • SPG64
    see all
  • Function

    In the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Could also be implicated in the prevention of platelet aggregation. Hydrolyzes ATP and ADP equally well.
  • Tissue specificity

    Expressed primarily on activated lymphoid cells. Also expressed in endothelial tissues. The vascular isoform and the placental isoform II are present in both placenta and umbilical vein, whereas placental isoform I is present in placenta only.
  • Sequence similarities

    Belongs to the GDA1/CD39 NTPase family.
  • Post-translational
    modifications

    The N-terminus is blocked.
    Palmitoylated in the N-terminal part.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab114445 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114445 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for contacting us. We have not tested this protein for activity, so unfortunately we have no data to provide in this regard.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up