Description

  • Product name

    Recombinant Human CD3D protein
    See all CD3D proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIY RCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
    • Predicted molecular weight

      11 kDa including tags
    • Amino acids

      22 to 105
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD3 antigen delta subunit
    • CD3 delta
    • CD3-delta
    • CD3d
    • CD3d antigen delta polypeptide (TiT3 complex)
    • CD3d molecule
    • CD3d molecule delta (CD3-TCR complex)
    • CD3D_HUMAN
    • IMD19
    • OKT3 delta chain
    • T cell receptor T3 delta chain
    • T-cell receptor T3 delta chain
    • T-cell surface glycoprotein CD3 delta chain
    • T3D
    see all
  • Function

    The CD3 complex mediates signal transduction.
  • Involvement in disease

    Defects in CD3D are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)/B(+)/NK(+) SCID) [MIM:608971]. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development.
  • Sequence similarities

    Contains 1 ITAM domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE of reduced ab167701 stained overnight with Coomassie Blue.
    DTT-reduced protein migrates as 18-25 kDa polypeptide in SDS-PAGE resulting from different glycosylation.

References

ab167701 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up