Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSQSIKGNHLVKVYDYQEDGSVLLTCDAE AKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQV YYRMCQNCIELNAATIS
    • Molecular weight

      13 kDa including tags
    • Amino acids

      23 to 116
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab140563 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • CD3 gamma
    • CD3-GAMMA
    • CD3g
    • CD3g antigen gamma polypeptide
    • CD3g antigen gamma polypeptide (TiT3 complex)
    • CD3g molecule gamma
    • CD3g molecule gamma (CD3 TCR complex)
    • CD3G_HUMAN
    • FLJ17620
    • FLJ17664
    • FLJ79544
    • FLJ94613
    • MGC138597
    • T cell antigen receptor complex gamma subunit of T3
    • T-cell receptor T3 gamma chain
    • T-cell surface glycoprotein CD3 gamma chain
    • T3G
    see all
  • Function

    The CD3 complex mediates signal transduction.
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
    Contains 1 ITAM domain.
  • Domain

    A di-leucine motif and a tyrosine-based motif are individually sufficient to induce both endocytosis and delivery to lysosomes.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS PAGE analysis of ab140563 (3 µg).

References

ab140563 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140563.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up