Description

  • Product name

    Recombinant Human CD4 protein (His tag)
    See all CD4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab222432 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSK LNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGL TANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLE LQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPL AFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMG KKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKN LTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDS GQVLLESNIKVLPTWSTPVQPHHHHHH
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      26 to 396
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_000607).

Specifications

Our Abpromise guarantee covers the use of ab222432 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • CD 4
    • CD4
    • CD4 (L3T4)
    • CD4 antigen
    • CD4 antigen (p55)
    • CD4 molecule
    • CD4 receptor
    • CD4+ Lymphocyte deficiency, included
    • CD4_HUMAN
    • CD4mut
    • L3T4
    • Leu3
    • Ly-4
    • Lymphocyte antigen CD4
    • MGC165891
    • OTTHUMP00000238897
    • p55
    • T cell antigen T4
    • T cell antigen T4/LEU3
    • T cell differentiation antigen L3T4
    • T cell OKT4 deficiency, included
    • T cell surface antigen T4/Leu 3
    • T cell surface antigen T4/Leu3
    • T cell surface glycoprotein CD4
    • T-cell surface antigen T4/Leu-3
    • T-cell surface glycoprotein CD4
    • W3/25
    • W3/25 antigen
    see all
  • Function

    Accessory protein for MHC class-II antigen/T-cell receptor interaction. May regulate T-cell activation. Induces the aggregation of lipid rafts.
  • Sequence similarities

    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Palmitoylation and association with LCK contribute to the enrichment of CD4 in lipid rafts.
  • Cellular localization

    Cell membrane. Localizes to lipid rafts. Removed from plasma membrane by HIV-1 Nef protein that increases clathrin-dependent endocytosis of this antigen to target it to lysosomal degradation. Cell surface expression is also down-modulated by HIV-1 Envelope polyprotein gp160 that interacts with, and sequesters CD4 in the endoplasmic reticulum.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222432.

    MWt 40-57 kDa (SDS-PAGE under reducing conditions).

References

ab222432 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222432.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up