Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDT WNRETHCHQH KYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFG VKQIATGVSD TICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQD RLRVDHHHHH H*
    • Molecular weight

      20 kDa including tags
    • Amino acids

      21 to 193
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Reconstituted protein solution can be stored at 4-7oC for 2-7 days. Aliquots of reconstituted samples are stable at < -20oC for 3 months.

General Info

  • Alternative names

    • AI326936
    • B cell associated molecule CD40
    • B cell surface antigen CD40
    • B cell-associated molecule
    • B-cell surface antigen CD40
    • Bp50
    • CD 40
    • CD40
    • CD40 antigen
    • CD40 antigen (TNF receptor superfamily member 5)
    • CD40 molecule
    • CD40 molecule, TNF receptor superfamily member 5
    • CD40 protein
    • CD40 type II isoform
    • CD40L receptor
    • CDw40
    • GP39
    • HIGM1
    • IGM
    • IMD3
    • MGC9013
    • Nerve growth factor receptor related B lymphocyte activation molecule
    • OTTHUMP00000031699
    • OTTHUMP00000031700
    • p50
    • T-BAM
    • TBAM
    • TNF receptor superfamily member 5
    • TNFRSF5
    • TNR5_HUMAN
    • TRAP
    • Tumor necrosis factor receptor superfamily , member 5
    • Tumor necrosis factor receptor superfamily member 5
    • Tumor necrosis factor receptor superfamily member 5 precursor
    • Tumor necrosis factor receptor superfamily, member 5, isoform CRA_a
    see all
  • Function

    Receptor for TNFSF5/CD40LG.
  • Tissue specificity

    B-cells and in primary carcinomas.
  • Involvement in disease

    Defects in CD40 are the cause of hyper-IgM immunodeficiency syndrome type 3 (HIGM3) [MIM:606843]; also known as hyper-IgM syndrome 3. HIGM3 is an autosomal recessive disorder which includes an inability of B cells to undergo isotype switching, one of the final differentiation steps in the humoral immune system, an inability to mount an antibody-specific immune response, and a lack of germinal center formation.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab151383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up