Recombinant human CD40 protein (Fc Chimera Active) (ab214998)

Description

  • Product name

    Recombinant human CD40 protein (Fc Chimera Active)
    See all CD40 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA assay.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDT WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETK DLVVQQAGTNKTDVVCGPQDRLR
    • Predicted molecular weight

      19 kDa
    • Amino acids

      21 to 193
    • Additional sequence information

      Extracellular domain fused to the N-terminus of the Fc region of Human IgG1 (AAH12419.1).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab214998 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    Lyophilized from 0.2µM filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100 µl sterile water. Add 1X PBS to the desired protein concentration.

General Info

  • Alternative names

    • AI326936
    • B cell associated molecule CD40
    • B cell surface antigen CD40
    • B cell-associated molecule
    • B-cell surface antigen CD40
    • Bp50
    • CD 40
    • CD40
    • CD40 antigen
    • CD40 antigen (TNF receptor superfamily member 5)
    • CD40 molecule
    • CD40 molecule, TNF receptor superfamily member 5
    • CD40 protein
    • CD40 type II isoform
    • CD40L receptor
    • CDw40
    • GP39
    • HIGM1
    • IGM
    • IMD3
    • MGC9013
    • Nerve growth factor receptor related B lymphocyte activation molecule
    • OTTHUMP00000031699
    • OTTHUMP00000031700
    • p50
    • T-BAM
    • TBAM
    • TNF receptor superfamily member 5
    • TNFRSF5
    • TNR5_HUMAN
    • TRAP
    • Tumor necrosis factor receptor superfamily , member 5
    • Tumor necrosis factor receptor superfamily member 5
    • Tumor necrosis factor receptor superfamily member 5 precursor
    • Tumor necrosis factor receptor superfamily, member 5, isoform CRA_a
    see all
  • Function

    Receptor for TNFSF5/CD40LG.
  • Tissue specificity

    B-cells and in primary carcinomas.
  • Involvement in disease

    Defects in CD40 are the cause of hyper-IgM immunodeficiency syndrome type 3 (HIGM3) [MIM:606843]; also known as hyper-IgM syndrome 3. HIGM3 is an autosomal recessive disorder which includes an inability of B cells to undergo isotype switching, one of the final differentiation steps in the humoral immune system, an inability to mount an antibody-specific immune response, and a lack of germinal center formation.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab214998 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

I confirm that Protein A can bind to this Fc chimera recombinant protein ab214998.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up