Description

  • Product name

    Recombinant Human CD42c/GP1BB protein (Tagged)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLL DALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALR GRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRL RRLRARARARAAARLSLTDPLVAERAGTDES
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      26 to 206
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 26 to 206. The signal peptide is not included. N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag. in vitro E.coli expression system.

Specifications

Our Abpromise guarantee covers the use of ab235070 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as CD42c

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Antigen CD42b beta
    • BDPLT1
    • BS
    • CD_antigen=CD42c
    • Flags: Precursor
    • Glycoprotein Ib (platelet) beta polypeptide
    • Glycoprotein Ib beta polypeptide
    • GP Ib beta
    • GP Ib beta subunit
    • GP1BB
    • GP1bbeta
    • GPIb beta
    • Nuclear localization signal deleted in velocardiofacial syndrome
    • Platelet glycoprotein Ib beta chain
    • Platelet glycoprotein Ib beta polypeptide
    see all
  • Relevance

    CD42c, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.
  • Cellular localization

    Membrane; Single-pass type I membrane protein.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235070.

References

ab235070 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235070.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up