Description

  • Product name

    Recombinant Human CD44 protein (His tag)
    See all CD44 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKAL SIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYP SNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIP
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      21 to 220
    • Tags

      His tag C-Terminus
    • Additional sequence information

      (AAH04372)

Specifications

Our Abpromise guarantee covers the use of ab173996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Please see notes section.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • LHR
    • BA-1
    • CD 44
    • CD44
    • CD44 antigen
    • CD44 molecule
    • CD44 molecule (Indian blood group)
    • CD44_HUMAN
    • CDw44
    • CDW44 antigen
    • Cell surface glycoprotein CD44
    • chondroitin sulfate proteoglycan 8
    • CSPG8
    • ECMR-III
    • Epican
    • Extracellular matrix receptor III
    • GP90 lymphocyte homing/adhesion receptor
    • HCELL
    • hematopoietic cell E- and L-selectin ligand
    • Heparan sulfate proteoglycan
    • Hermes antigen
    • homing function and Indian blood group system
    • HSA
    • HUTCH-I
    • HUTCH1
    • HUTCHI
    • Hyaluronate receptor
    • IN
    • INLU-related p80 Glycoprotein
    • MC56
    • MDU2
    • MDU3
    • MGC10468
    • MIC4
    • MUTCH I
    • MUTCH1
    • PGP-1
    • PGP-I
    • PGP1
    • Phagocytic glycoprotein 1
    • Phagocytic glycoprotein I
    • Soluble CD44
    see all
  • Function

    Receptor for hyaluronic acid (HA). Mediates cell-cell and cell-matrix interactions through its affinity for HA, and possibly also through its affinity for other ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). Adhesion with HA plays an important role in cell migration, tumor growth and progression. Also involved in lymphocyte activation, recirculation and homing, and in hematopoiesis. Altered expression or dysfunction causes numerous pathogenic phenotypes. Great protein heterogeneity due to numerous alternative splicing and post-translational modification events.
  • Tissue specificity

    Isoform 10 (epithelial isoform) is expressed by cells of epithelium and highly expressed by carcinomas. Expression is repressed in neuroblastoma cells.
  • Sequence similarities

    Contains 1 Link domain.
  • Domain

    The lectin-like LINK domain is responsible for hyaluronan binding.
  • Post-translational
    modifications

    Proteolytically cleaved in the extracellular matrix by specific proteinases (possibly MMPs) in several cell lines and tumors.
    N-glycosylated.
    O-glycosylated; contains more-or-less-sulfated chondroitin sulfate glycans, whose number may affect the accessibility of specific proteinases to their cleavage site(s).
    Phosphorylated; activation of PKC results in the dephosphorylation of Ser-706 (constitutive phosphorylation site), and the phosphorylation of Ser-672.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Reduced SDS-PAGE analysis of ab173996 stained overnight with Coomassie Blue.

    Predicted MW of protein with tag is 22.9 kDa, but DTT-reduced protein migrates as 35-58 kDa due to glycosylation.

References

ab173996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up