Recombinant human CD47 protein (Active) (ab174029)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: ELISA, Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human CD47 protein (Active)
See all CD47 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA.
When Recombinant Human CD172a / SIRP alpha Fc Chimera is coated at 1 µg/mL, ab174029 binds with apparent KD < 1 nM.
-
Purity
> 95 % SDS-PAGE.
Purified by Immobilized metal affinity chromatography. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTF DGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTE LTREGETIIELKYRVVSWFSP -
Predicted molecular weight
16 kDa including tags -
Amino acids
19 to 139 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab174029 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
After reconstitution, store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
pH: 7.40
Constituents: PBS, 5% Trehalose
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- Antigen identified by monoclonal antibody 1D8
- Antigenic surface determinant protein OA3
- CD 47
see all -
Function
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. -
Tissue specificity
Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain. -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
Images
-
Immobilized ab221235 at 5 μg/mL (100 μL/well) binds ab174029.
Linear range: 2-13 ng/mL (QC tested).
-
Immobilized Anti-CD47 MAb, Human IgG4 (clone 5F9) at 2 μg/mL (100 μL/well) binds ab174029.
Linear range: 0.4-3 ng/mL (Routinely tested).
-
Anti-Human CD47 MAb (Human IgG4) captured on CM5 chip via Anti-Human IgG Fc antibodies surface can bind Human CD47 (His Tag) with an affinity constant of 1.66 nM as determined in a SPR assay (Biacore T200) (Routinely tested).
-
Immobilized Human SIRP alpha (Fc Tag) (HPLC-verified) at 5 µg/mL (100 µL/well) can bind Human CD47 (His Tag) with a linear range of 6-50 ng/mL (QC tested).
-
Anti-Human CD47 MAb (Human IgG4) captured on CM5 chip via Anti-Human IgG Fc antibodies surface, binds ab174029.
Affinity constant: 1.66 nM as determined in a SPR assay (Biacore T200) (Routinely tested).
-
Reduced ab174029 on SDS-PAGE, stained overnight with Coomassie Blue.
Purity of protein > 95%
The protein migrates as 35-45 kDa under reducing condition due to glycosylation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab174029 has been referenced in 1 publication.
- Cheng X et al. Homology Modeling-Based in Silico Affinity Maturation Improves the Affinity of a Nanobody. Int J Mol Sci 20:N/A (2019). PubMed: 31461846