Recombinant Human CD47 protein (Fc Chimera) (ab216207)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human CD47 protein (Fc Chimera)
See all CD47 proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTF DGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTE LTREGETIIELKYRVVSWFSP -
Predicted molecular weight
40 kDa -
Amino acids
19 to 139 -
Additional sequence information
extracellular domain Fc fusion protein
-
Specifications
Our Abpromise guarantee covers the use of ab216207 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.48% Tris, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- Antigen identified by monoclonal antibody 1D8
- Antigenic surface determinant protein OA3
- CD 47
see all -
Function
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. -
Tissue specificity
Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain. -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab216207 has been referenced in 1 publication.
- Deuse T et al. The SIRPa-CD47 immune checkpoint in NK cells. J Exp Med 218:N/A (2021). PubMed: 33416832