Bioactive grade

Recombinant human CD47 protein (Fc Chimera Active) (ab220587)

Description

  • Product name

    Recombinant human CD47 protein (Fc Chimera Active)
    See all CD47 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab220587 at 2 μg/ml can bind Human SIRP alpha, His Tag with a linear range of 16-250 ng/ml.

  • Purity

    > 95 % SDS-PAGE.
    >90% as determined by SEC-HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTF DGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTE LTREGETIIELKYRVVSWFSP
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      19 to 139
    • Additional sequence information

      Fused with a human IgG1 Fc tag (Pro 100 - Lys 330; P01857) at the C-terminus (NP_942088).

Specifications

Our Abpromise guarantee covers the use of ab220587 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Antigen identified by monoclonal antibody 1D8
    • Antigenic surface determinant protein OA3
    • CD 47
    • CD47
    • CD47 antigen
    • CD47 antigen (Rh-related antigen, integrin-associated signal transducer)
    • CD47 glycoprotein
    • CD47 molecule
    • CD47_HUMAN
    • IAP
    • Integrin Associated Protein
    • Integrin associated signal transducer
    • Integrin-associated protein
    • Leukocyte surface antigen CD47
    • MER 6
    • MER6
    • OA 3
    • OA3
    • OTTHUMP00000041152
    • OTTHUMP00000041153
    • Protein MER6
    • Rh related antigen
    • Surface antigen identified by monoclonal antibody 1D8
    see all
  • Function

    Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
  • Tissue specificity

    Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • Serial dilutions of Anti-Human CD47 Neutralizing Antibody were added into Human CD47, Fc Tag (HPLC-verified) (ab220587): Biotinylated Human SIRP alpha, Fc,Avitag (ab246052) binding reactions. The half maximal inhibitory concentration (IC50) is 0.5431 μg/mL

  • The purity of Human CD47 (Fc Tag) (HPLC-verified) was greater than 90% as determined by SEC-HPLC.
  • Human CD47 (Fc Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • Loaded Recombinant human CD47 protein (Fc Chimera Active) (ab220587) on Protein A Biosensor, can bind Human SIRP alpha, His Tag (HPLC-verified) (ab174006) with an affinity constant of 1.1 μM as determined in BLI assay

  • FACS analysis shows that the binding of Human CD47 to ACHN expressing SIRP-a was inhibited by increasing concentration of neutralizing SIRP-a antibody. The concentration of Human CD47 used is 10 μg/mL. IC50=8.39 μg/mL

  • SDS-PAGE analysis of reduced ab220587 stained overnight with Coomassie Blue.

    The protein migrates as 50-65 kDa on a SDS-PAGE gel under reducing conditions due to glycosylation.

  • The purity of ab220587 was greater than 90% as determined by SEC-HPLC.

  • Immobilized ab220587 at 2 μg/ml can bind Human SIRP alpha, His Tag with a linear range of 16-250 ng/ml.

References

ab220587 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220587.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up