Description

  • Product name

    Recombinant Human CD48 protein
    See all CD48 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKY FESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQ VLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKEL QNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSVDDIEG RMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      50 kDa including tags
    • Amino acids

      27 to 220
    • Tags

      His tag C-Terminus
    • Additional sequence information

      FC-6His tag at the C-terminus. Full length mature form, without signal peptide, without propeptide.

Specifications

Our Abpromise guarantee covers the use of ab191957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

General Info

  • Alternative names

    • Antigen CD48
    • B cell membrane protein
    • B lymphocyte activation marker BLAST 1
    • B-cell activation marker
    • B-lymphocyte activation marker BLAST-1
    • BCM 1 surface antigen
    • BCM1
    • BCM1 surface antigen
    • BLAST
    • BLAST 1
    • BLAST1
    • CD 48
    • CD48
    • CD48 antigen
    • CD48 antigen (B cell membrane protein)
    • CD48 molecule
    • CD48 protein
    • CD48_HUMAN
    • hCD48
    • Leucocyte antigen MEM 102
    • Leukocyte antigen MEM-102
    • mCD48
    • MEM 102
    • MEM-102
    • MEM102
    • Signaling lymphocytic activation molecule 2
    • SLAM family member 2
    • SLAMF 2
    • SLAMF2
    • TCT.1
    see all
  • Function

    Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab191957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up