Description

  • Product name

    Recombinant Human CD48 protein (His tag)
    See all CD48 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRK SKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKI KLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFP KELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSHHH HHH
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      27 to 220
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 27 to 220. The signal peptide and propeptide are not included.

Specifications

Our Abpromise guarantee covers the use of ab223022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • Antigen CD48
    • B cell membrane protein
    • B lymphocyte activation marker BLAST 1
    • B-cell activation marker
    • B-lymphocyte activation marker BLAST-1
    • BCM 1 surface antigen
    • BCM1
    • BCM1 surface antigen
    • BLAST
    • BLAST 1
    • BLAST1
    • CD 48
    • CD48
    • CD48 antigen
    • CD48 antigen (B cell membrane protein)
    • CD48 molecule
    • CD48 protein
    • CD48_HUMAN
    • hCD48
    • Leucocyte antigen MEM 102
    • Leukocyte antigen MEM-102
    • mCD48
    • MEM 102
    • MEM-102
    • MEM102
    • Signaling lymphocytic activation molecule 2
    • SLAM family member 2
    • SLAMF 2
    • SLAMF2
    • TCT.1
    see all
  • Function

    Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 3 µg of ab223022 analyzed by 15% SDS-PAGE.

    28-40kDa (under reducing conditions).

References

ab223022 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223022.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up