Description

  • Product name

    Recombinant Human CD53 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSL TLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLA ILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGT SDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGM SFALTLNCQIDKTSQTIGL
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      1 to 219

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AI323659
    • Antigen MOX44 identified by monoclonal antibody MRC-OX44
    • CD 53
    • CD53
    • CD53 antigen
    • CD53 antigen, isoform CRA_b
    • CD53 glycoprotein
    • Cd53 molecule
    • CD53 tetraspan antigen
    • CD53_HUMAN
    • Cell surface glycoprotein CD53
    • Leukocyte antigen MRC OX-44
    • Leukocyte surface antigen CD53
    • MOX 44
    • MOX44
    • OTTHUMP00000059505
    • Ox-44
    • OX44
    • RATOX44
    • Tetraspanin 25
    • Tetraspanin-25
    • Tetraspanin25
    • Transmembrane glycoprotein
    • TSPAN 25
    • Tspan-25
    • TSPAN25
    see all
  • Function

    May be involved in growth regulation in hematopoietic cells.
  • Tissue specificity

    B-cells, monocytes, macrophages, neutrophils, single (CD4 or CD8) positive thymocytes and peripheral T-cells.
  • Sequence similarities

    Belongs to the tetraspanin (TM4SF) family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152265 stained with Coomassie Blue.

References

ab152265 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152265.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up