Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSFSQQIYGVVYGNVTFHVPSNVPLKEVL WKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEM ESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLI MYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTC IPSSGHSRHR
    • Molecular weight

      24 kDa including tags
    • Amino acids

      29 to 215
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Extracellular domain (NP_001770).

Specifications

Our Abpromise guarantee covers the use of ab187438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    Previously labelled as LFA3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 10% Glycerol, 90% Phosphate Buffer

General Info

  • Alternative names

    • AG3
    • CD58
    • CD58 antigen
    • CD58 antigen (lymphocyte function associated antigen 3)1
    • CD58 antigen, (lymphocyte function associated antigen 3)
    • CD58 molecule
    • FLJ23181
    • FLJ43722
    • LFA 3
    • LFA-3
    • LFA3
    • LFA3_HUMAN
    • Lymphocyte Function Associated Antigen Type 3
    • Lymphocyte function-associated antigen 3
    • Surface glycoprotein LFA 3
    • Surface glycoprotein LFA-3
    see all
  • Function

    Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg of ab187438.

References

ab187438 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up