Recombinant human CD58 protein (Fc Chimera Active) (ab221335)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human CD58 protein (Fc Chimera Active)
See all CD58 proteins and peptides -
Biological activity
Immobilized Human CD2, His Tag at 2μg/mL (100 μL/well) can bind ab221335 with a linear range of 10-156 ng/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFK NRVYLDTVSG SLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPS PTLTCALTNGSIEVQCMIPEHY NSHRGLIMYSWDCPMEQCKRNSTSIY FKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPS SGHSRHR -
Predicted molecular weight
48 kDa including tags -
Amino acids
29 to 215 -
Additional sequence information
extracellular domain with a Human IgG1 Fc tag at the C-terminus (aa 100-330).
-
Specifications
Our Abpromise guarantee covers the use of ab221335 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
No activity loss is observed after storage at:
- 4-8°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
Previously labelled as LFA3.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, 0.44% L-Arginine, 0.87% Sodium chloride
Lyophilized from 0.22 µm filtered solutionThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- AG3
- CD58
- CD58 antigen
see all -
Function
Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells. -
Sequence similarities
Contains 1 Ig-like C2-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
Images
-
SDS-PAGE analysis of ab221335.
The gel was stained overnight with Coomassie Blue. ab221335 has a calculated MW of 48 kDa. Due to glycosylation, the protein migrates as 60-75 kDa under reducing conditions (Lane 1) and 125-150 kDa under non-reducing conditions (Lane 2).
-
Immobilized Human CD2, His Tag at 2μg/mL (100 μL/well) binds ab221335 with a linear range of 10-156 ng/mL.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab221335 has not yet been referenced specifically in any publications.