Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFK NRVYLDTVSG SLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPS PTLTCALTNGSIEVQCMIPEHY NSHRGLIMYSWDCPMEQCKRNSTSIY FKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPS SGHSRHR
    • Molecular weight

      48 kDa including tags
    • Amino acids

      29 to 215
    • Additional sequence information

      extracellular domain with a Human IgG1 Fc tag at the C-terminus (aa 100-330).

Specifications

Our Abpromise guarantee covers the use of ab221335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Immobilized Human CD2, His Tag at 2μg/mL (100 μL/well) can bind ab221335 with a linear range of 10-156 ng/mL.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

    No activity loss is observed after storage at:

    1. 4-8°C for 12 months in lyophilized state;
    2. -70°C for 3 months under sterile conditions after reconstitution.

    Previously labelled as LFA3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, 0.44% L-Arginine, 0.87% Sodium chloride

    Lyophilized from 0.22 µm filtered solution

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product with sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • AG3
    • CD58
    • CD58 antigen
    • CD58 antigen (lymphocyte function associated antigen 3)1
    • CD58 antigen, (lymphocyte function associated antigen 3)
    • CD58 molecule
    • FLJ23181
    • FLJ43722
    • LFA 3
    • LFA-3
    • LFA3
    • LFA3_HUMAN
    • Lymphocyte Function Associated Antigen Type 3
    • Lymphocyte function-associated antigen 3
    • Surface glycoprotein LFA 3
    • Surface glycoprotein LFA-3
    see all
  • Function

    Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab221335.

    The gel was stained overnight with Coomassie Blue. ab221335 has a calculated MW of 48 kDa. Due to glycosylation, the protein migrates as 60-75 kDa under reducing conditions (Lane 1) and 125-150 kDa under non-reducing conditions (Lane 2).

  • Immobilized Human CD2, His Tag at 2μg/mL (100 μL/well) binds ab221335 with a linear range of 10-156 ng/mL.

References

ab221335 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up