Recombinant Human CD59 protein (ab134887)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Endotoxin level: = 5.000 Eu/µg
- Tags: His tag N-Terminus, T7 tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human CD59 protein
See all CD59 proteins and peptides -
Purity
> 90 % SDS-PAGE.
ab134887 was refolded using temperature shift inclusion body refolding technology and chromatographically purified. -
Endotoxin level
= 5.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGGEFALVQCYNCPNPTADCKTAVNC SSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLC NFNEQLEN -
Predicted molecular weight
12 kDa including tags -
Amino acids
26 to 102 -
Tags
His tag N-Terminus , T7 tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab134887 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituent: 0.32% Tris HCl
Proprietary formulation of NaCl, KCl, EDTA, Arginine, DTT and Glycerol.
General Info
-
Alternative names
- 16.3A5
- 1F5
- 1F5 antigen
see all -
Function
Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.
The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes. -
Involvement in disease
Defects in CD59 are the cause of CD59 deficiency (CD59D) [MIM:612300]. -
Sequence similarities
Contains 1 UPAR/Ly6 domain. -
Post-translational
modificationsN- and O-glycosylated. The N-glycosylation mainly consists of a family of biantennary complex-type structures with and without lactosamine extensions and outer arm fucose residues. Also significant amounts of triantennary complexes (22%). Variable sialylation also present in the Asn-43 oligosaccharide. The predominant O-glycans are mono-sialylated forms of the disaccharide, Gal-beta-1,3GalNAc, and their sites of attachment are probably on Thr-76 and Thr-77. The GPI-anchor of soluble urinary CD59 has no inositol-associated phospholipid, but is composed of seven different GPI-anchor variants of one or more monosaccharide units. Major variants contain sialic acid, mannose and glucosamine Sialic acid linked to an N-acetylhexosamine-galactose arm is present in two variants.
Glycated. Glycation is found in diabetic subjects, but only at minimal levels in nondiabetic subjects. Glycated CD59 lacks MAC-inhibitory function and confers to vascular complications of diabetes. -
Cellular localization
Cell membrane. Secreted. Soluble form found in a number of tissues. - Information by UniProt
Images
-
SDS PAGE analysis of ab134887 (lanes 4-6), using BSA as a reference protein (lanes 1-3).
Lane 1: 10µg BSA
Lane 2: 5µg BSA
Lane 3: 1µg BSA
Lane 4: 10µl ab134887
Lane 5: 5µl ab134887
Lane 6: 1µl ab134887
-
SDS PAGE analysis of ab134887 (lanes 4-5), using BSA as a reference protein (lanes 1-3). 4-20% gradient gel was used.
Lane 1: 10µl BSA
Lane 2: 5µl BSA
Lane 3: 1µl BSA
Lane 4: 20µl ab134887 (Stored at -20°C for 180 days)
Lane 5: 20µl ab134887 (Stored at -20°C, then shift to 4°C for 30 days)
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab134887 has not yet been referenced specifically in any publications.