Description

  • Product name

    Recombinant Human CD59 protein
    See all CD59 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab134887 was refolded using temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFALVQCYNCPNPTADCKTAVNC SSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCRKDLC NFNEQLEN
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      26 to 102
    • Tags

      His tag N-Terminus , T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl,EDTA,KCl,arginine,DTT and Glycerol

General Info

  • Alternative names

    • 16.3A5
    • 1F5
    • 1F5 antigen
    • 20 kDa homologous restriction factor
    • CD 59
    • CD_antigen=CD59
    • CD59
    • CD59 antigen
    • CD59 antigen complement regulatory protein
    • CD59 antigen p18 20
    • CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344)
    • CD59 glycoprotein
    • CD59 molecule
    • CD59 molecule complement regulatory protein
    • CD59_HUMAN
    • Cd59a
    • Complement regulatory protein
    • EJ16
    • EJ30
    • EL32
    • FLJ38134
    • FLJ92039
    • G344
    • HRF 20
    • HRF-20
    • HRF20
    • Human leukocyte antigen MIC11
    • Ly 6 like protein
    • Lymphocytic antigen CD59/MEM43
    • MAC inhibitory protein
    • MAC IP
    • MAC-inhibitory protein
    • MAC-IP
    • MACIF
    • MACIP
    • MEM43
    • MEM43 antigen
    • Membrane attack complex (MAC) inhibition factor
    • Membrane attack complex inhibition factor
    • Membrane inhibitor of reactive lysis
    • MGC2354
    • MIC11
    • MIN1
    • MIN2
    • MIN3
    • MIRL
    • MSK21
    • p18 20
    • Protectin
    • Surface antigen recognized by monoclonal antibody 16.3A5
    • T cell activating protein
    see all
  • Function

    Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.
    The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes.
  • Involvement in disease

    Defects in CD59 are the cause of CD59 deficiency (CD59D) [MIM:612300].
  • Sequence similarities

    Contains 1 UPAR/Ly6 domain.
  • Post-translational
    modifications

    N- and O-glycosylated. The N-glycosylation mainly consists of a family of biantennary complex-type structures with and without lactosamine extensions and outer arm fucose residues. Also significant amounts of triantennary complexes (22%). Variable sialylation also present in the Asn-43 oligosaccharide. The predominant O-glycans are mono-sialylated forms of the disaccharide, Gal-beta-1,3GalNAc, and their sites of attachment are probably on Thr-76 and Thr-77. The GPI-anchor of soluble urinary CD59 has no inositol-associated phospholipid, but is composed of seven different GPI-anchor variants of one or more monosaccharide units. Major variants contain sialic acid, mannose and glucosamine Sialic acid linked to an N-acetylhexosamine-galactose arm is present in two variants.
    Glycated. Glycation is found in diabetic subjects, but only at minimal levels in nondiabetic subjects. Glycated CD59 lacks MAC-inhibitory function and confers to vascular complications of diabetes.
  • Cellular localization

    Cell membrane. Secreted. Soluble form found in a number of tissues.
  • Information by UniProt

Images

  • SDS PAGE analysis of ab134887 (lanes 4-6), using BSA as a reference protein (lanes 1-3).

    Lane 1: 10µg BSA

    Lane 2: 5µg BSA

    Lane 3: 1µg BSA

    Lane 4: 10µl ab134887

    Lane 5: 5µl ab134887

    Lane 6: 1µl ab134887

References

ab134887 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134887.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up