Description

  • Product name

    Recombinant Human CD5L/CT-2 protein
    See all CD5L/CT-2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab152030 was determined to be >95% pure by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAVLCRELGCGA ASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDED AGASCENPESSFSPVPEGVRLADGPGHCKGRVEVKHQNQWYTVCQTGWSL RAAKVVCRQLGCGRAVLTQKRCNKHAYGRKPIWLSQMSCSGREATLQDCP SGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVC DDNWGEKEDQVVCKQLGCGKSLSPSFRDRKCYGPGVGRIWLDNVRCSGEE QSLEQCQHRFWGFHDCTHQEDVAVICSGVDHHHHHH
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      20 to 347
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

    Previously labelled as CD5L. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • AAC-11
    • AIM
    • API6
    • APOPTOSIS INHIBITOR 6
    • APOPTOSIS INHIBITOR OF MACROPHAGES
    • CD5 antigen like (scavenger receptor cysteine rich family)
    • CD5 antigen-like
    • Cd5l
    • CD5L_HUMAN
    • CT 2
    • CT-2
    • Highly similar to ANTIGEN WC1.1 [Bos taurus]
    • IgM associated peptide
    • IgM-associated peptide
    • Pdp
    • PRO229
    • SCAVENGER RECEPTOR CYSTEINE-RICH FAMILY
    • SP ALPHA
    • SP-alpha
    • Spalpha
    see all
  • Function

    May play a role in the regulation of the immune system. Seems to play a role as an inhibitor of apoptosis.
  • Tissue specificity

    Expressed in spleen, lymph node, thymus, bone marrow, and fetal liver, but not in non-lymphoid tissues.
  • Sequence similarities

    Contains 3 SRCR domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab152030 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152030.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up