Description

  • Product name

    Recombinant Human CD62E protein
    See all CD62E proteins and peptides
  • Biological activity

    Measured by its ability to support adhesion of U937 cells, a Human hystiocytic lymphoma cell line.
  • Purity

    > 95 % SDS-PAGE.
    Purity : Greater than 95% by SDS-PAGE gel and HPLC analyses. Sterile filtered through a 0.2 micron filter.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYW IGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKD VGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSG LKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMET MQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFD CEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSP AGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALS NPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNE KPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGST QLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACP EGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP
    • Predicted molecular weight

      59 kDa
    • Amino acids

      22 to 556

Specifications

Our Abpromise guarantee covers the use of ab104357 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Measured by its ability to support adhesion of U937 cells, a Human hystiocytic lymphoma cell line.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.

    pH: 7.00
    Constituent: 0.164% Sodium phosphate

  • Reconstitution
    Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

General Info

  • Alternative names

    • CD26E
    • CD62 antigen-like family member E
    • CD62E
    • E selectin
    • E-selectin
    • ELAM
    • ELAM-1
    • ELAM1
    • Endothelial adhesion molecule 1
    • Endothelial leukocyte adhesion molecule 1
    • ESEL
    • LECAM2
    • Leukocyte-endothelial cell adhesion molecule 2
    • LYAM2_HUMAN
    • Sele
    • Selectin E
    see all
  • Function

    Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.
  • Sequence similarities

    Belongs to the selectin/LECAM family.
    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 6 Sushi (CCP/SCR) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab104357 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104357.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up