Description

  • Product name

    Recombinant Human CD62P protein (Fc Chimera)
    See all CD62P proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYW IGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSA PGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYG PECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSK LECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFS CEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPL TAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPL ESPVHGSMDCSP SLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWT APAPVCQALQCQDLPVPNEARVNC SHPFGAFRYQSVCSFTCNEGLLLV GASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTM TCVQPLGSSSYK STCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQG SLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKG IASLPTPGLQ CPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLI GDSTLSCRPSGQWTAVTPACRA VKCSELHVNKPIAMNCSNLWGNFSYG SICSFHCLEGQLLNGSAQTACQENGHWSTTVPTC QAGPLTIQEA
    • Predicted molecular weight

      107 kDa including tags
    • Amino acids

      42 to 771
    • Additional sequence information

      Extracellular domain fused with a human IgG1 Fc tag at the C-terminus (AAN06828).

Specifications

Our Abpromise guarantee covers the use of ab221316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, Sodium chloride, L-Arginine

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Antigen CD62
    • CD62
    • CD62 antigen-like family member P
    • CD62P
    • GMP 140
    • GMP-140
    • GMP140
    • GMRP
    • Granule membrane protein 140
    • Granulocyte membrane protein
    • GRMP
    • LECAM 3
    • LECAM3
    • Leukocyte endothelial cell adhesion molecule 3
    • Leukocyte-endothelial cell adhesion molecule 3
    • LYAM3_HUMAN
    • P Selectin
    • P-selectin
    • PADGEM
    • Platelet activation dependent granule-external membrane protein
    • Platelet alpha granule membrane protein
    • PSEL
    • Selectin P (granule membrane protein 140kDa, antigen CD62)
    • SELP
    see all
  • Function

    Ca(2+)-dependent receptor for myeloid cells that binds to carbohydrates on neutrophils and monocytes. Mediates the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized is sialyl-Lewis X. Mediates rapid rolling of leukocyte rolling over vascular surfaces during the initial steps in inflammation through interaction with PSGL1.
  • Tissue specificity

    Stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. Upon cell activation by agonists, P-selectin is transported rapidly to the cell surface.
  • Involvement in disease

    Defects in SELP may be a cause of susceptibility to ischemic stroke (ISCHSTR) [MIM:601367]; also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors.
  • Sequence similarities

    Belongs to the selectin/LECAM family.
    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 9 Sushi (CCP/SCR) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab221316 stained overnight with Coomassie Blue.

    The reducing protein migrates as 146-160 kDa in SDS-PAGE due to Glycosylation.

References

ab221316 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up