Bioactive grade

Recombinant human CD64 protein (Active) (Biotin) (ab246071)

Description

  • Product name

    Recombinant human CD64 protein (Active) (Biotin)
    See all CD64 proteins and peptides
  • Biological activity

    Immobilized Yervoy Ipilumimab at 5 μg/mL (100 μL/well) can bind ab246071 with a linear range of 0.2-3 ng/mL.

     

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQT STPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT EGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGT YHCSGMGKHRYTSAGISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETK LLLQRPGLQLYFSFYMGSKTLRGRNTSSEYQILTARREDSGLYWCEAATE DGNVLKRSPELELQVLGLQLPTP
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      16 to 288
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      AviTag sequence: GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246071 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.4
    Constituents: PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD 64
    • CD64
    • CD64 antigen
    • CD64A
    • CD64b
    • CD64c
    • Fc fragment of IgG high affinity Ia receptor
    • Fc fragment of IgG high affinity Ib receptor
    • Fc fragment of IgG high affinity Ic receptor
    • Fc fragment of IgG, high affinity Ia, receptor (CD64)
    • Fc fragment of IgG, high affinity Ia, receptor for
    • Fc fragment of IgG, high affinity Ia, receptor for (CD64)
    • Fc fragment of IgG, high affinity Ib, receptor (CD64)
    • Fc fragment of IgG, high affinity Ib, receptor for
    • Fc fragment of IgG, high affinity Ic, receptor (CD64)
    • Fc fragment of IgG, high affinity Ic, receptor (CD64), pseudogene
    • Fc fragment of IgG, high affinity Ic, receptor for
    • Fc gamma receptor
    • Fc gamma receptor I
    • Fc gamma receptor I A1
    • Fc gamma receptor I B2
    • Fc gamma RI
    • Fc gamma RIA
    • Fc gamma RIB
    • Fc of IgG high affinity Ia receptor
    • Fc-gamma RI
    • Fc-gamma RIA
    • Fc-gamma RIC
    • FCG 1
    • FCG1
    • FcgammaRI
    • FcgammaRIa
    • FCGR 1
    • FCGR1
    • FCGR1_HUMAN
    • FCGR1A
    • FCGR1B
    • FCGR1C
    • FcRI
    • FcRIB
    • FCRIC
    • FLJ18345
    • HFcgammaRIB
    • High affinity immunoglobulin gamma Fc receptor I
    • High affinity immunoglobulin gamma Fc receptor IB
    • IGFR 1
    • IGFR1
    • IGFRB
    • IGFRC
    • IgG Fc receptor I
    • IgG Fc receptor IB
    • IgG Fc receptor IC
    • Immunoglobulin G Fc receptor I
    • Immunoglobulin G Fc receptor IB
    • Immunoglobulin G Fc receptor IC
    • MGC137713
    see all
  • Function

    High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
  • Tissue specificity

    Monocyte/macrophage specific.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. FCGR1 family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Phosphorylated on serine residues.
  • Cellular localization

    Cell membrane. Stabilized at the cell membrane through interaction with FCER1G.
  • Information by UniProt

Images

  • Biotinylated Human CD64, His,Avitag (SPR�& BLI verified) captured on Biotin CAP- Series S Sensor Chip can bind Herceptin with an affinity constant of 1.02 nM as determined in a SPR assay (Biacore T200).
  • Loaded Biotinylated Human CD64, His,Avitag (SPR�& BLI verified) on SA Biosensor, can bind Herceptin with an affinity constant of 0.334 nM as determined in BLI assay.
  • SDS-PAGE analysis of ab246071 under reducing conditions.

    The protein migrates as 50-65 kDa under reducing conditions due to glycosylation.

  • Immobilized Yervoy Ipilumimab at 5 μg/mL (100 μL/well) can bind ab246071 with a linear range of 0.2-3 ng/mL.

     

References

ab246071 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246071.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up