Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEQLTIEAVPSNAAEGKEVLLLVH NLPQDPRGYNWYKG ETVDANRRIIGYVISNQQITPGPAYSNRETIYPN ASLLMRNVTRNDTGSYTLQVIKLNLMSEEV TGQFSVHPETPKPSISSN NSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNR TL TLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYH AGVNLNLSCHAA SNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYA CHTTNSATGRNRTTVRMITVSD
    • Molecular weight
      35 kDa including tags
    • Amino acids
      35 to 320
    • Tags
      His-T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169879 was expressed in E.coli as inclusion bodies, then refolded using “temperature shift inclusion body refolding” technology and chromatographically purified and sterile-filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • Carcinoembryonic antigen CGM6
    • Carcinoembryonic antigen gene family member 6
    • Carcinoembryonic antigen related cell adhesion molecule 8
    • Carcinoembryonic antigen-related cell adhesion molecule 8
    • CD 66b
    • CD 67
    • CD66b
    • CD66b antigen
    • CD67
    • CD67 antigen
    • CEACAM 8
    • CEACAM8
    • CEAM8_HUMAN
    • CGM 6
    • CGM6
    • NCA 95
    • NCA95
    • Non-specific cross-reacting antigen NCA-95
    • Nonspecific cross reacting antigen NCA 95
    • Nonspecific cross reacting antigen NCA95
    see all
  • Tissue specificity
    Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab169879 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up