Recombinant Human CD68 protein (Fc Chimera) (ab174015)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTS HGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATV HPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVH LQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG HLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPL GQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS
    • Molecular weight
      59 kDa including tags
    • Amino acids
      22 to 319
    • Additional sequence information
      Fused with Fc fragment of Human IgG1 at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab174015 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C long term. Avoid freeze / thaw cycle.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.

General Info

  • Alternative names
    • CD 68
    • CD68
    • CD68 antigen
    • CD68 molecule
    • CD68_HUMAN
    • DKFZp686M18236
    • gp11
    • Gp110
    • LAMP4
    • MACROPHAGE ANTIGEN CD68
    • Macrophage antigen CD68 (microsialin)
    • Macrosialin
    • SCARD1
    • Scavenger receptor class D member 1
    see all
  • Function
    Could play a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. Binds to tissue- and organ-specific lectins or selectins, allowing homing of macrophage subsets to particular sites. Rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane may allow macrophages to crawl over selectin-bearing substrates or other cells.
  • Tissue specificity
    Highly expressed by blood monocytes and tissue macrophages. Also expressed in lymphocytes, fibroblasts and endothelial cells. Expressed in many tumor cell lines which could allow them to attach to selectins on vascular endothelium, facilitating their dissemination to secondary sites.
  • Sequence similarities
    Belongs to the LAMP family.
  • Post-translational
    modifications
    N- and O-glycosylated.
  • Cellular localization
    Cell membrane and Endosome membrane. Lysosome membrane.
  • Information by UniProt

Images

  • Reduced SDS-PAGE analysis of ab174015, stained overnight with Coomassie Blue.

References

ab174015 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174015.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up