Recombinant human CD68 protein (Fc Chimera Active) (ab214829)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level: < 0.060 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human CD68 protein (Fc Chimera Active)
See all CD68 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA assay.
-
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
< 0.060 Eu/µg -
Expression system
CHO cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTS HGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATV HPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVH LQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG HLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPL GQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS -
Amino acids
22 to 319 -
Additional sequence information
Extracellular domain fused to the N-terminus of the Fc region of Human IgG1.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab214829 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 100% PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100 µL sterile water. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- CD 68
- CD68
- CD68 antigen
see all -
Function
Could play a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. Binds to tissue- and organ-specific lectins or selectins, allowing homing of macrophage subsets to particular sites. Rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane may allow macrophages to crawl over selectin-bearing substrates or other cells. -
Tissue specificity
Highly expressed by blood monocytes and tissue macrophages. Also expressed in lymphocytes, fibroblasts and endothelial cells. Expressed in many tumor cell lines which could allow them to attach to selectins on vascular endothelium, facilitating their dissemination to secondary sites. -
Sequence similarities
Belongs to the LAMP family. -
Post-translational
modificationsN- and O-glycosylated. -
Cellular localization
Cell membrane and Endosome membrane. Lysosome membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab214829 has not yet been referenced specifically in any publications.