Description

  • Product name

    Recombinant Human CD6/T12 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      CGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAAR VLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELM
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      308 to 400

Specifications

Our Abpromise guarantee covers the use of ab116984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

    Previously labelled as CD6. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CD_antigen=CD6
    • CD6
    • CD6 antigen Tp120
    • CD6 molecule
    • CD6_HUMAN
    • FLJ44171
    • OX52
    • T cell differentiation antigen CD6
    • T-cell differentiation antigen CD6
    • T12
    • TP120
    see all
  • Function

    Involved in cell adhesion. Binds to CD166.
  • Tissue specificity

    Expressed by thymocytes, mature T-cells, a subset of B-cells known as B-1 cells, and by some cells in the brain.
  • Sequence similarities

    Contains 3 SRCR domains.
  • Post-translational
    modifications

    After T-cell activation, becomes hyperphosphorylated on Ser and Thr residues and phosphorylated on Tyr residues.
    Contains intrachain disulfide bond(s).
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116984 at approximately 35.86kDa.
    Stained with Coomassie Blue.

References

ab116984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up