Overview

Description

  • Nature

    Recombinant
  • Source

    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Molecular weight

      19 kDa including tags
    • Amino acids

      39 to 193
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab129130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Determined by its ability to stimulate Human IL8 production by Human PBMC using a concentration range of 10.0-25.0 ng/ml. Note: Results may vary with PBMC donors.
  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Purity

    > 95 % SDS-PAGE.
    Purity: > 95%, by SDS-PAGE and HPLC analysis.
  • Form

    Lyophilised
  • Additional notes

    Endotoxin level: < 0.1 ng/µg of soluble CD70. Determined by its ability to stimulate Human IL8 production by Human PBMC using a concentration range of 10.0-25.0 ng/ml. Note: Results may vary with PBMC donors.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstituted ab129130 is stable for at least 3 months when stored in working aliquots with a carrier protein at -20°C. Avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • CD 27L
    • CD 70
    • CD27 L
    • CD27 LG
    • CD27 ligand
    • CD27-L
    • CD27L
    • CD27LG
    • CD70
    • CD70 antigen
    • CD70 molecule
    • CD70_HUMAN
    • Ki 24 antigen
    • Ki24 antigen
    • Surface antigen CD70
    • TNFSF 7
    • TNFSF7
    • Tumor necrosis factor (ligand) superfamily, member 7
    • Tumor necrosis factor ligand superfamily member 7
    see all
  • Function

    Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab129130 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Here is the amino acid sequence of the CD70/CD27L protein ab129130. Please note that this monomer is the extracellular region, with a His tag at the N terminus.

HHHHHHHHPSPGGSGGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPR LYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASR HHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLT GTLLPSRNTDETFFGVQWVRP

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up