For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-cd70-protein-ab129130.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Cytokines TNF Superfamily
Share by email

Recombinant human CD70 protein (ab129130)

  • Datasheet
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Expression system: CHO cells
  • Purity: > 95% SDS-PAGE
  • Active: Yes
  • Tags: His tag N-Terminus
  • Suitable for: Functional Studies, SDS-PAGE, HPLC

You may also be interested in

Primary
Product image
Anti-CD70 antibody (ab175389)
Primary
Product image
Anti-CD70 antibody [EPR21946-290] (ab223292)
ELISA
Product image
Human CD70 ELISA Kit (ab264621)

View more associated products

Description

  • Product name

    Recombinant human CD70 protein
    See all CD70 proteins and peptides
  • Biological activity

    Determined by its ability to stimulate Human IL8 production by Human PBMC using a concentration range of 10.0-25.0 ng/ml. Note: Results may vary with PBMC donors.
  • Purity

    > 95 % SDS-PAGE.
    Purity: > 95%, by SDS-PAGE and HPLC analysis.
  • Expression system

    CHO cells
  • Accession

    P32970
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Predicted molecular weight

      19 kDa including tags
    • Amino acids

      39 to 193
    • Tags

      His tag N-Terminus

Associated products

  • Related Products

    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-6X His tag® antibody [4D11] (ab5000)

Specifications

Our Abpromise guarantee covers the use of ab129130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilized
  • Additional notes

    Endotoxin level: < 0.1 ng/µg of soluble CD70. Determined by its ability to stimulate Human IL8 production by Human PBMC using a concentration range of 10.0-25.0 ng/ml. Note: Results may vary with PBMC donors.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstituted ab129130 is stable for at least 3 months when stored in working aliquots with a carrier protein at -20°C. Avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • CD 27L
    • CD 70
    • CD27 L
    • CD27 LG
    • CD27 ligand
    • CD27-L
    • CD27L
    • CD27LG
    • CD70
    • CD70 antigen
    • CD70 molecule
    • CD70_HUMAN
    • Ki 24 antigen
    • Ki24 antigen
    • Surface antigen CD70
    • TNFSF 7
    • TNFSF7
    • Tumor necrosis factor (ligand) superfamily, member 7
    • Tumor necrosis factor ligand superfamily member 7
    see all
  • Function

    Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession P32970 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab129130? Please let us know so that we can cite the reference in this datasheet.

    ab129130 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Is the protein provided as a monomer?

    Read More

    Abcam community

    Verified customer

    Asked on May 14 2014

    Answer

    Here is the amino acid sequence of the CD70/CD27L protein ab129130. Please note that this monomer is the extracellular region, with a His tag at the N terminus.

    HHHHHHHHPSPGGSGGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPR LYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASR HHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLT GTLLPSRNTDETFFGVQWVRP

    Read More

    Tom Ruyle

    Abcam Scientific Support

    Answered on May 14 2014

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.