Question (75835) | Recombinant human CD70 protein (ab129130)

Go to datasheet (ab129130)

Question

Is the protein provided as a monomer?

Answer

Here is the amino acid sequence of the CD70/CD27L protein ab129130. Please note that this monomer is the extracellular region, with a His tag at the N terminus.

HHHHHHHHPSPGGSGGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPR LYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASR HHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLT GTLLPSRNTDETFFGVQWVRP

Sign up