Description

  • Product name

    Recombinant Human CD70 protein (His tag)
    See all CD70 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab222430 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSF LHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSP ASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETF FGVQWVRPHHHHHH
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      39 to 193
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_001243).

Specifications

Our Abpromise guarantee covers the use of ab222430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • CD 27L
    • CD 70
    • CD27 L
    • CD27 LG
    • CD27 ligand
    • CD27-L
    • CD27L
    • CD27LG
    • CD70
    • CD70 antigen
    • CD70 molecule
    • CD70_HUMAN
    • Ki 24 antigen
    • Ki24 antigen
    • Surface antigen CD70
    • TNFSF 7
    • TNFSF7
    • Tumor necrosis factor (ligand) superfamily, member 7
    • Tumor necrosis factor ligand superfamily member 7
    see all
  • Function

    Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222430.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

References

ab222430 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up