Overview

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      KEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQ TLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSY KGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRT KAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTK TTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYN FFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGML GIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEK NLVKHLNQGTDEDIYLLGKATLPGFRTIHCVDHHHHHH
    • Molecular weight

      45 kDa including tags
    • Amino acids

      27 to 406
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab151639 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. It is an Supplied as a 0.2 µM filtered solution.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride

General Info

  • Alternative names

    • 6 sialyltransferase
    • 6-sialyltransferase 1
    • 6-ST 1
    • Alpha 2
    • Alpha 2,6 ST
    • Alpha 2,6 ST 1
    • B cell antigen CD75
    • B-cell antigen CD75
    • Beta galactoside alpha 2,6 sialyltransferase 1
    • Beta-galactoside alpha-2
    • CMP N acetylneuraminate beta galactosamide alpha 2,6 sialyltransferase 1
    • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2
    • MGC48859
    • Sialyltransferase 1
    • Sialyltransferase 1 (beta galactoside alpha 2,6 sialyltransferase)
    • SIAT1
    • SIAT1_HUMAN
    • ST6 beta galactosamide alpha 2,6 sialyltranferase 1
    • ST6Gal I
    • ST6GAL1
    • ST6GalI
    • ST6N
    see all
  • Function

    Transfers sialic acid from the donor of substrate CMP-sialic acid to galactose containing acceptor substrates.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 29 family.
  • Post-translational
    modifications

    The soluble form derives from the membrane form by proteolytic processing.
    The HB-6, CDW75, and CD76 differentiation antigens are cell-surface carbohydrate determinants generated by this enzyme.
  • Cellular localization

    Golgi apparatus > Golgi stack membrane. Secreted. Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.
  • Information by UniProt

References

ab151639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up