Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLR DHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKS
    • Amino acids
      96 to 195
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159508 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6 sialyltransferase
    • 6-sialyltransferase 1
    • 6-ST 1
    • Alpha 2
    • Alpha 2,6 ST
    • Alpha 2,6 ST 1
    • B cell antigen CD75
    • B-cell antigen CD75
    • Beta galactoside alpha 2,6 sialyltransferase 1
    • Beta-galactoside alpha-2
    • CMP N acetylneuraminate beta galactosamide alpha 2,6 sialyltransferase 1
    • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2
    • MGC48859
    • Sialyltransferase 1
    • Sialyltransferase 1 (beta galactoside alpha 2,6 sialyltransferase)
    • SIAT1
    • SIAT1_HUMAN
    • ST6 beta galactosamide alpha 2,6 sialyltranferase 1
    • ST6Gal I
    • ST6GAL1
    • ST6GalI
    • ST6N
    see all
  • Function
    Transfers sialic acid from the donor of substrate CMP-sialic acid to galactose containing acceptor substrates.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 29 family.
  • Post-translational
    modifications
    The soluble form derives from the membrane form by proteolytic processing.
    The HB-6, CDW75, and CD76 differentiation antigens are cell-surface carbohydrate determinants generated by this enzyme.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Secreted. Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.
  • Information by UniProt

Images

  • ab159508 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159508 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159508.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up