Description

  • Product name

    Recombinant Human CD79a protein (His tag)
    See all CD79a proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab227390 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLG PGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRP FLDMGEGTKNRLEHHHHHH
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      33 to 143
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_001774).

Specifications

Our Abpromise guarantee covers the use of ab227390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • B lymphocyte-specific MB1 protein
    • B-cell antigen receptor complex-associated protein alpha chain
    • CD 79a
    • CD79a
    • CD79A antigen
    • CD79a antigen (immunoglobulin-associated alpha)
    • CD79a molecule, immunoglobulin-associated alpha
    • CD79A_HUMAN
    • Ig alpha
    • Ig-alpha
    • IGA
    • IgM-alpha
    • Immunoglobulin-associated alpha
    • Ly54
    • MB-1 membrane glycoprotein
    • MB1
    • Membrane-bound immunoglobulin-associated protein
    • Surface IgM-associated protein
    see all
  • Function

    Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B cells.
  • Tissue specificity

    B-cells.
  • Involvement in disease

    Defects in CD79A are the cause of agammaglobulinemia type 3 (AGM3) [MIM:613501]. It is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life. Note=Two different mutations, one at the splice donor site of intron 2 and the other at the splice acceptor site for exon 3, have been identified. Both mutations give rise to a truncated protein.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 ITAM domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine, serine and threonine residues upon B-cell activation. Phosphorylation of tyrosine residues by Src-family kinases is an early and essential feature of the BCR signaling cascade. The phosphorylated tyrosines serve as docking sites for SH2-domain containing kinases, leading to their activation which in turn leads to phosphorylation of downstream targets. Phosphorylation of serine and threonine residues may prevent subsequent tyrosine phosphorylation.
  • Cellular localization

    Cell membrane. Following antigen binding, the BCR has been shown to translocate from detergent-soluble regions of the cell membrane to lipid rafts although signal transduction through the complex can also occur outside lipid rafts.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab227390.

    MW: 18-28 kDa (SDS-PAGE under reducing conditions).

References

ab227390 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up