Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLW KQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNN TSEVYQGCGTELRVMGFSTLAQLKQRNTLKDHHHHHH
    • Molecular weight

      15 kDa
    • Amino acids

      29 to 159
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Lyophilized from a 0.2 µM filtered solution.
  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • AGM6
    • B cell antigen receptor complex associated protein beta chain
    • B cell specific glycoprotein B29
    • B-cell antigen receptor complex-associated protein beta chain
    • B-cell-specific glycoprotein B29
    • B29
    • B29/Ig-beta/CD79b
    • CD 79b
    • CD79b
    • CD79b antigen
    • CD79b antigen (immunoglobulin associated beta)
    • CD79b molecule
    • CD79b molecule immunoglobulin associated beta
    • CD79b protein
    • CD79B_HUMAN
    • Ig beta
    • Ig-beta
    • IGB
    • Igbeta
    • Immunoglobulin associated B29
    • Immunoglobulin associated B29 protein
    • Immunoglobulin associated beta
    • Immunoglobulin associated protein
    • Immunoglobulin-associated B29 protein
    • MGC108607
    see all
  • Function

    Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
  • Tissue specificity

    B-cells.
  • Involvement in disease

    Defects in CD79B are the cause of agammaglobulinemia type 6 (AGM6) [MIM:612692]. It is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
    Contains 1 ITAM domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine upon B-cell activation.
  • Cellular localization

    Cell membrane. Following antigen binding, the BCR has been shown to translocate from detergent-soluble regions of the cell membrane to lipid rafts although signal transduction through the complex can also occur outside lipid rafts.
  • Information by UniProt

References

ab153795 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up