Description

  • Product name

    Recombinant Human CD80 protein
    See all CD80 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIW PEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEV TLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNA INTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTT KQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRES VRPV
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      35 to 288

Specifications

Our Abpromise guarantee covers the use of ab131745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Activation B7-1 antigen
    • B lymphocyte activation antigen B7
    • B7
    • B7-1
    • B7-1 antigen
    • B7.1
    • BB1
    • CD28 antigen ligand 1
    • CD28LG
    • CD28LG1
    • CD80
    • CD80 antigen
    • CD80 antigen (CD28 antigen ligand 1, B7-1 antigen)
    • CD80 molecule
    • CD80_HUMAN
    • Costimulatory factor CD80
    • costimulatory molecule variant IgV-CD80
    • CTLA-4 counter-receptor B7.1
    • LAB7
    • T-lymphocyte activation antigen CD80
    see all
  • Function

    Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28 or CTLA-4 to this receptor.
  • Tissue specificity

    Expressed on activated B-cells, macrophages and dendritic cells.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131745, stained with Coomassie Blue.

References

ab131745 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up