Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMF VGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVK QFY
    • Amino acids
      25 to 127
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152267 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 26 kDa cell surface protein TAPA 1
    • 26 kDa cell surface protein TAPA-1
    • 26 kDa cell surface protein TAPA1
    • CD 81
    • CD81
    • CD81 antigen
    • CD81 antigen (target of antiproliferative antibody 1)
    • CD81 molecule
    • CD81_HUMAN
    • CVID6
    • S5.7
    • TAPA 1
    • TAPA1
    • Target of the antiproliferative antibody 1
    • Tetraspanin 28
    • Tetraspanin-28
    • Tetraspanin28
    • Tspan 28
    • Tspan-28
    • Tspan28
    see all
  • Function
    May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May acts a the viral receptor for HCV.
  • Tissue specificity
    Hematolymphoid, neuroectodermal and mesenchymal tumor cell lines.
  • Involvement in disease
    Defects in CD81 are the cause of immunodeficiency common variable type 6 (CVID6) [MIM:613496]; also called antibody deficiency due to CD81 defect. CVID6 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low.
  • Sequence similarities
    Belongs to the tetraspanin (TM4SF) family.
  • Post-translational
    modifications
    Not glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab152267 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152267 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152267.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up