Recombinant Human CD81 protein (Fc Chimera His Tag) (ab226886)

Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGS STLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLEPKSCDK THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK VSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Molecular weight

      37 kDa including tags
    • Amino acids

      113 to 201
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain with hIgG-His tag at the C-terminus (NP_004347).

Specifications

Our Abpromise guarantee covers the use of ab226886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab226886 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • 26 kDa cell surface protein TAPA 1
    • 26 kDa cell surface protein TAPA-1
    • 26 kDa cell surface protein TAPA1
    • CD 81
    • CD81
    • CD81 antigen
    • CD81 antigen (target of antiproliferative antibody 1)
    • CD81 molecule
    • CD81_HUMAN
    • CVID6
    • S5.7
    • TAPA 1
    • TAPA1
    • Target of the antiproliferative antibody 1
    • Tetraspanin 28
    • Tetraspanin-28
    • Tetraspanin28
    • Tspan 28
    • Tspan-28
    • Tspan28
    see all
  • Function

    May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May acts a the viral receptor for HCV.
  • Tissue specificity

    Hematolymphoid, neuroectodermal and mesenchymal tumor cell lines.
  • Involvement in disease

    Defects in CD81 are the cause of immunodeficiency common variable type 6 (CVID6) [MIM:613496]; also called antibody deficiency due to CD81 defect. CVID6 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low.
  • Sequence similarities

    Belongs to the tetraspanin (TM4SF) family.
  • Post-translational
    modifications

    Not glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab226886.

    MW: 40-57 kDa (SDS-PAGE under reducing conditions).

References

ab226886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up