Description

  • Product name

    Recombinant human CD84 protein
    See all CD84 proteins and peptides
  • Biological activity

    Measured in a cell proliferation assay using PHA stimulated Human T cells in the presence of anti-CD3.

    The ED50 for this effect is typically 2-6 µg/ml in the presence of anti-CD3 immobilized at 20 ng/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETA PVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTT KRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPL GEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRT HHTG
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      22 to 225
    • Tags

      His tag C-Terminus
    • Additional sequence information

      AAH20063. Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab182681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    DTT-reduced CD84 protein migrates as 35-45 kDa due to glycosylation.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD_antigen=CD84
    • CD84
    • CD84 antigen
    • CD84 molecule
    • CDw84
    • Cell surface antigen MAX.3
    • hCD84
    • Hly9 beta
    • Hly9-beta
    • Leucocyte differentiation antigen CD84
    • Leukocyte Antigen
    • Leukocyte antigen CD84
    • Leukocyte differentiation antigen
    • Leukocyte differentiation antigen CD84
    • LY9B
    • mCD84
    • Signaling lymphocytic activation molecule 5
    • SLAF5_HUMAN
    • SLAM family member 5
    • SLAMF5
    see all
  • Function

    Plays a role as adhesion receptor functioning by homophilic interactions and by clustering. Recruits SH2 domain-containing proteins SH2D1A/SAP. Increases proliferative responses of activated T-cells and SH2D1A/SAP does not seen be required for this process. Homophilic interactions enhance interferon gamma/IFNG secretion in lymphocytes and induce platelet stimulation via a SH2D1A/SAP-dependent pathway. May serve as a marker for hematopoietic progenitor cells.
  • Tissue specificity

    Predominantly expressed in hematopoietic tissues, such as lymph node, spleen and peripheral leukocytes. Expressed in macrophages, B-cells, monocytes, platelets, thymocytes, T-cells and dendritic cells. Highly expressed in memory T-cells.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Developmental stage

    Expression is slightly increased in naive B-cells after the first dividion. By contrast, expression on memory B-cells decreased with each successive division.
  • Domain

    ITSM (immunoreceptor tyrosine-based switch motif) motif is a cytoplasmic motif which may bind SH2D1A.
  • Post-translational
    modifications

    Phosphorylated by tyrosine-protein kinase LCK on tyrosine residues following ligation induced by agonist monoclonal antibody. The association with SH2D1A/SAP is dependent of tyrosines phosphorylation of its cytoplasmic domain Phosphorylated on Tyr-296 and Tyr-316 following platelet aggregation.
    N-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • The purity of ab182681 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue.

References

ab182681 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up